Michaelmickeywilliamsjr.com belongs to LINODE-AP Linode, LLC, US. Check the list of other websites hosted by LINODE-AP Linode, LLC, US.
In terms of rank-to-traffic ratio, michaelmickeywilliamsjr.com has 15,024 unique users per day, viewing 75,795 pages. The rank based value of michaelmickeywilliamsjr.com is 113,400 USD. Every user makes 5.35 pageviews on average.
Michaelmickeywilliamsjr.com boasts a link base consisting of 703 referring domains and 954 external backlinks, as revealed by the data obtained from web network scanning.
Michaelmickeywilliamsjr.com top-level domain belongs to .COM domain zone. Check other webpages in .COM zone.
According the last verification test in January 29, 2021, michaelmickeywilliamsjr.com has an expired SSL certificate issued by cPanel, Inc. (expired on February 15, 2021). Click button “Update” SSL Information at the Safety Information section. Check the list of websites using SSL by cPanel, Inc..
Based on data from Google Safe Browsing and Symantec michaelmickeywilliamsjr.com is a fairly safe domain.
Domain | michaelmickeywilliamsjr.com |
Issuer Organization | cPanel, Inc. |
Issuer | cPanel, Inc. Certification Authority |
Algorithm | RSA-SHA256 |
Valid form | 11/17/2020 |
Expiration | 02/15/2021 |
Signed | Certificate is not self signed |
Additional Domains |
michaelmickeywilliamsjr.com cpanel.michaelmickeywilliamsjr.com cpcalendars.michaelmickeywilliamsjr.com cpcontacts.michaelmickeywilliamsjr.com mail.michaelmickeywilliamsjr.com webdisk.michaelmickeywilliamsjr.com webmail.michaelmickeywilliamsjr.com www.michaelmickeywilliamsjr.com |
Alexa Rank shows how popular michaelmickeywilliamsjr.com is in comparison with other sites. The most popular site has Alexa Rank equals 1. If michaelmickeywilliamsjr.com has Alexa Rank equals 100,000, then it is in TOP 100,000 popular sites in the world. The rank is calculated using a combination of average daily visitors to michaelmickeywilliamsjr.com and pageviews on michaelmickeywilliamsjr.com over the past 3 months.
ASN ID: 63949
ASN Title: LINODE-AP Linode, LLC, USLast Update: 10/11/2024
#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/whois_tou.html
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/whois_reporting/index.html
#
# Copyright 1997-2018, American Registry for Internet Numbers, Ltd.
#
ASNumber: 63488 - 64197
ASName: IANA-RSVD
ASHandle: AS63488
RegDate: 2013-06-07
Updated: 2013-06-07
Ref: https://rdap.arin.net/registry/autnum/63488
OrgName: Internet Assigned Numbers Authority
OrgId: IANA
Address: 12025 Waterfront Drive
Address: Suite 300
City: Los Angeles
StateProv: CA
PostalCode: 90292
Country: US
RegDate:
Updated: 2012-08-31
Ref: https://rdap.arin.net/registry/entity/IANA
OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820
OrgAbuseEmail: abuse@iana.org
OrgAbuseRef: https://rdap.arin.net/registry/entity/IANA-IP-ARIN
OrgTechHandle: IANA-IP-ARIN
OrgTechName: ICANN
OrgTechPhone: +1-310-301-5820
OrgTechEmail: abuse@iana.org
OrgTechRef: https://rdap.arin.net/registry/entity/IANA-IP-ARIN
#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/whois_tou.html
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/whois_reporting/index.html
#
# Copyright 1997-2018, American Registry for Internet Numbers, Ltd.
#
Domain Name: MICHAELMICKEYWILLIAMSJR.COM
Registry Domain ID: 2723805991_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois-service.virtualcloud.co
Registrar URL: http://sav.com
Updated Date: 2023-09-08T07:27:16Z
Creation Date: 2022-09-07T18:15:50Z
Registry Expiry Date: 2024-09-07T18:15:50Z
Registrar: Sav.com, LLC
Registrar IANA ID: 609
Registrar Abuse Contact Email: abuse-contact@sav.com
Registrar Abuse Contact Phone: +1.8885808790
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.PARKINGCREW.NET
Name Server: NS2.PARKINGCREW.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2024-03-27T16:56:35Z
Host | A Record | TTL |
---|
Host | MX Record | Priority | TTL |
---|
Host | NS Record | TTL |
---|
Host | TXT Record | TTL |
---|
not found